Recombinant Full Length Human WDR20 Protein, C-Flag-tagged
Cat.No. : | WDR20-701HFL |
Product Overview : | Recombinant Full Length Human WDR20 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a WD repeat-containing protein that functions to preserve and regulate the activity of the USP12-UAF1 deubiquitinating enzyme complex. Multiple alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 62.7 kDa |
AA Sequence : | MATEGGGKEMNEIKTQFTTREGLYKLLPHSEYSRPNRVPFNSQGSNPVRVSFVNLNDQSGNGDRLCFNVG RELYFYIYKGVRKAADLSKPIDKRIYKGTQPTCHDFNHLTATAESVSLLVGFSAGQVQLIDPIKKETSKL FNEERLIDKSRVTCVKWVHGSESLFLVAHSSGNMYLYNVEHTCGTTAPHYQLLKQGESFAVHTCKSKSTR NPLLKWTVGEGALNEFAFSPDGKFLACVSQDGFLRVFNFDSVELHGTMKSYFGGLLCVCWSPDGKYIVTG GEDDLVTVWSFVDCRVIARGHGHKSWVSVVAFDPYTTSVEEGDPMEFSGSDEDFQDLLHFGRDRANSTQS RLSKRNSTDSRPVSVTYRFGSVGQDTQLCLWDLTEDILFPHQPLSRARTHTNVMNATSPPAGSNGNSVTT PGNSVPPPLPRSNSLPHSAVSNAGSKSSVMDGAIASGVSKFATLSLHDRKERHHEKDHKRNHSMGHISSK SSDKLNLVTKTKTDPAKTLGTPLCPRMEDVPLLEPLICKKIAHERLTVLIFLEDCIVTACQEGFICTWGR PGKVVSFNPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | WDR20 WD repeat domain 20 [ Homo sapiens (human) ] |
Official Symbol | WDR20 |
Synonyms | DMR; Bun107 |
Gene ID | 91833 |
mRNA Refseq | NM_144574.4 |
Protein Refseq | NP_653175.2 |
MIM | 617741 |
UniProt ID | Q8TBZ3 |
◆ Recombinant Proteins | ||
WDR20-5195R | Recombinant Rhesus monkey WDR20 Protein, His-tagged | +Inquiry |
Wdr20-6975M | Recombinant Mouse Wdr20 Protein, Myc/DDK-tagged | +Inquiry |
WDR20-701HFL | Recombinant Full Length Human WDR20 Protein, C-Flag-tagged | +Inquiry |
WDR20-2353H | Recombinant Human WDR20 Protein, His (Fc)-Avi-tagged | +Inquiry |
WDR20-5008R | Recombinant Rhesus Macaque WDR20 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR20-353HCL | Recombinant Human WDR20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WDR20 Products
Required fields are marked with *
My Review for All WDR20 Products
Required fields are marked with *
0
Inquiry Basket