Recombinant Full Length Human Vesicle-Associated Membrane Protein 1(Vamp1) Protein, His-Tagged
Cat.No. : | RFL27678HF |
Product Overview : | Recombinant Full Length Human Vesicle-associated membrane protein 1(VAMP1) Protein (P23763) (1-118aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-118) |
Form : | Lyophilized powder |
AA Sequence : | MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | VAMP1 |
Synonyms | VAMP1; SYB1; Vesicle-associated membrane protein 1; VAMP-1; Synaptobrevin-1 |
UniProt ID | P23763 |
◆ Recombinant Proteins | ||
VAMP1-543H | Recombinant Human VAMP1 Protein, His&GST-tagged | +Inquiry |
VAMP1-5140R | Recombinant Rhesus monkey VAMP1 Protein, His-tagged | +Inquiry |
VAMP1-6147R | Recombinant Rat VAMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Vamp1-6891M | Recombinant Mouse Vamp1 Protein, Myc/DDK-tagged | +Inquiry |
VAMP1-31695TH | Recombinant Human VAMP1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAMP1-439HCL | Recombinant Human VAMP1 293 Cell Lysate | +Inquiry |
VAMP1-441HCL | Recombinant Human VAMP1 293 Cell Lysate | +Inquiry |
VAMP1-440HCL | Recombinant Human VAMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VAMP1 Products
Required fields are marked with *
My Review for All VAMP1 Products
Required fields are marked with *
0
Inquiry Basket