Recombinant Full Length Human VASP Protein, C-Flag-tagged
Cat.No. : | VASP-1409HFL |
Product Overview : | Recombinant Full Length Human VASP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family. Ena-VASP family members contain an EHV1 N-terminal domain that binds proteins containing E/DFPPPPXD/E motifs and targets Ena-VASP proteins to focal adhesions. In the mid-region of the protein, family members have a proline-rich domain that binds SH3 and WW domain-containing proteins. Their C-terminal EVH2 domain mediates tetramerization and binds both G and F actin. VASP is associated with filamentous actin formation and likely plays a widespread role in cell adhesion and motility. VASP may also be involved in the intracellular signaling pathways that regulate integrin-extracellular matrix interactions. VASP is regulated by the cyclic nucleotide-dependent kinases PKA and PKG. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.6 kDa |
AA Sequence : | MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRGV KYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPPPPALPTWSVPNGPSPEEVEQ QKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPPAPPL PAAQGPGGGGAGAPGLAAAIAGAKLRKVSKQEEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQV GEKTPKDESANQEEPEARVPAQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQE LLEEVKKELQKVKEEIIEAFVQELRKRGSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways : | Fc gamma R-mediated phagocytosis, Focal adhesion, Leukocyte transendothelial migration |
Full Length : | Full L. |
Gene Name | VASP vasodilator stimulated phosphoprotein [ Homo sapiens (human) ] |
Official Symbol | VASP |
Synonyms | vasodilator-stimulated phosphoprotein |
Gene ID | 7408 |
mRNA Refseq | NM_003370.4 |
Protein Refseq | NP_003361.1 |
MIM | 601703 |
UniProt ID | P50552 |
◆ Recombinant Proteins | ||
VASP-9999M | Recombinant Mouse VASP Protein, His (Fc)-Avi-tagged | +Inquiry |
VASP-2332H | Recombinant Human VASP Protein, His (Fc)-Avi-tagged | +Inquiry |
VASP-1409HFL | Recombinant Full Length Human VASP Protein, C-Flag-tagged | +Inquiry |
VASP-17986M | Recombinant Mouse VASP Protein | +Inquiry |
VASP-30994TH | Recombinant Human VASP, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VASP-426HCL | Recombinant Human VASP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VASP Products
Required fields are marked with *
My Review for All VASP Products
Required fields are marked with *
0
Inquiry Basket