Recombinant Full Length Human Uncharacterized Protein C5Orf4(C5Orf4) Protein, His-Tagged
Cat.No. : | RFL32820HF |
Product Overview : | Recombinant Full Length Human Uncharacterized protein C5orf4(C5orf4) Protein (Q96IV6) (1-333aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-333) |
Form : | Lyophilized powder |
AA Sequence : | MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFW QAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKN EPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTL IEEVLFYYSHRLLHHPTFYKKIHKKHHEWTAPIGVISLYAHPIEHAVSNMLPVIVGPLVM GSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTD TMFKQTKAYERHVLLLGFTPLSESIPDSPKRME |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FAXDC2 |
Synonyms | FAXDC2; C5orf4; Fatty acid hydroxylase domain-containing protein 2 |
UniProt ID | Q96IV6 |
◆ Native Proteins | ||
VCL tail-900T | Native Turkey VCL tail Protein | +Inquiry |
Hp-25 | Native Helicobacter pylori Antigen | +Inquiry |
IgG-253R | Native Rabbit IgG Protein, Tag Free, Agarose Conjugated | +Inquiry |
PRF1-55H | Native Human Perforin | +Inquiry |
IL16-29736TH | Native Human IL16 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRR1-4882HCL | Recombinant Human KRR1 293 Cell Lysate | +Inquiry |
MRPL50-4159HCL | Recombinant Human MRPL50 293 Cell Lysate | +Inquiry |
LCN6-4799HCL | Recombinant Human LCN6 293 Cell Lysate | +Inquiry |
ZFAND6-184HCL | Recombinant Human ZFAND6 293 Cell Lysate | +Inquiry |
ATG9A-8620HCL | Recombinant Human ATG9A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAXDC2 Products
Required fields are marked with *
My Review for All FAXDC2 Products
Required fields are marked with *
0
Inquiry Basket