Recombinant Full Length Human Uncharacterized Aarf Domain-Containing Protein Kinase 4(Adck4) Protein, His-Tagged
Cat.No. : | RFL25532HF |
Product Overview : | Recombinant Full Length Human Uncharacterized aarF domain-containing protein kinase 4(ADCK4) Protein (Q96D53) (1-544aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-544) |
Form : | Lyophilized powder |
AA Sequence : | MWLKVGGLLRGTGGQLGQTVGWPCGALGPGPHRWGPCGGSWAQKFYQDGPGRGLGEEDIR RAREARPRKTPRPQLSDRSRERKVPASRISRLANFGGLAVGLGLGVLAEMAKKSMPGGRL QSEGGSGLDSSPFLSEANAERIVQTLCTVRGAALKVGQMLSIQDNSFISPQLQHIFERVR QSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQY PGIAQSIQSDVQNLLAVLKMSAALPAGLFAEQSLQALQQELAWECDYRREAACAQNFRQL LANDPFFRVPAVVKELCTTRVLGMELAGGVPLDQCQGLSQDLRNQICFQLLTLCLRELFE FRFMQTDPNWANFLYDASSHQVTLLDFGASREFGTEFTDHYIEVVKAAADGDRDCVLQKS RDLKFLTGFETKAFSDAHVEAVMILGEPFATQGPYDFGSGETARRIQDLIPVLLRHRLCP PPEETYALHRKLAGAFLACAHLRAHIACRDLFQDTYHRYWASRQPDAATAGSLPTKGDSW VDPS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COQ8B |
Synonyms | COQ8B; ADCK4; Atypical kinase COQ8B, mitochondrial; AarF domain-containing protein kinase 4; Coenzyme Q protein 8B |
UniProt ID | Q96D53 |
◆ Recombinant Proteins | ||
RRAGA-4033R | Recombinant Rhesus monkey RRAGA Protein, His-tagged | +Inquiry |
XRCC4-3757H | Recombinant Human XRCC4, GST-tagged | +Inquiry |
RFL32549BF | Recombinant Full Length Balaenoptera Physalus Nadh-Ubiquinone Oxidoreductase Chain 4L(Mt-Nd4L) Protein, His-Tagged | +Inquiry |
RFL13846YF | Recombinant Full Length Protein Psie Homolog(Psie) Protein, His-Tagged | +Inquiry |
EFCAB2-12299H | Recombinant Human EFCAB2, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MBP-6949M | Native Mouse Myelin basic protein | +Inquiry |
Lectin-1723C | Native Canavalia ensiformis Lectin, FITC conjugated | +Inquiry |
COL2A1-1647H | Native Human COL2A1 Protein | +Inquiry |
PLG-15H | Native Human Plasminogen Protein | +Inquiry |
HP-8153H | Native Human Serum Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CARS-7845HCL | Recombinant Human CARS 293 Cell Lysate | +Inquiry |
MYBPHL-4040HCL | Recombinant Human MYBPHL 293 Cell Lysate | +Inquiry |
CABS1-8026HCL | Recombinant Human C4orf35 293 Cell Lysate | +Inquiry |
LGALS3-4766HCL | Recombinant Human LGALS3 293 Cell Lysate | +Inquiry |
HOXC4-5417HCL | Recombinant Human HOXC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COQ8B Products
Required fields are marked with *
My Review for All COQ8B Products
Required fields are marked with *
0
Inquiry Basket