Recombinant Full Length Human UHRF1 Protein, C-Flag-tagged
Cat.No. : | UHRF1-1289HFL |
Product Overview : | Recombinant Full Length Human UHRF1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 90.9 kDa |
AA Sequence : | MGVFAVPPLSSDTMWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHT LFDYEVRLNDTIQLLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMW DETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVV QMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLN DCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECD MAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRT KECTIVPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFT YTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKY APAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALAN REREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAGSPRRTSKKTKVEPYSLTAQQSSLIRED KSNAKLWNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVF SCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | UHRF1 ubiquitin like with PHD and ring finger domains 1 [ Homo sapiens (human) ] |
Official Symbol | UHRF1 |
Synonyms | Np95; hNP95; ICBP90; RNF106; TDRD22; hUHRF1; huNp95 |
Gene ID | 29128 |
mRNA Refseq | NM_013282.5 |
Protein Refseq | NP_037414.3 |
MIM | 607990 |
UniProt ID | Q96T88 |
◆ Recombinant Proteins | ||
UHRF1-237H | Recombinant Human UHRF1 Protein, GST-tagged | +Inquiry |
UHRF1-2312H | Recombinant Human UHRF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
UHRF1-233H | Recombinant Human UHRF1 Protein, GST-tagged | +Inquiry |
UHRF1-6439R | Recombinant Rat UHRF1 Protein | +Inquiry |
UHRF1-239H | Recombinant Human UHRF1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UHRF1-508HCL | Recombinant Human UHRF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UHRF1 Products
Required fields are marked with *
My Review for All UHRF1 Products
Required fields are marked with *
0
Inquiry Basket