Recombinant Full Length Human Tyrosine-Protein Kinase Styk1(Styk1) Protein, His-Tagged
Cat.No. : | RFL2023HF |
Product Overview : | Recombinant Full Length Human Tyrosine-protein kinase STYK1(STYK1) Protein (Q6J9G0) (1-422aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-422) |
Form : | Lyophilized powder |
AA Sequence : | MGMTRMLLECSLSDKLCVIQEKQYEVIIVPTLLVTIFLILLGVILWLFIREQRTQQQRSG PQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQI CSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQDFLGRIQFHQYLGKHKNLVQL EGCCTEKLPLYMVLEDVAQGDLLSFLWTCRRDVMTMDGLLYDLTEKQVYHIGKQVLLALE FLQEKHLFHGDVAARNILMQSDLTAKLCGLGLAYEVYTRGAISSTQTIPLKWLAPERLLL RPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIMKRPSSCTHTMYSIMK SCWRWREADRPSPRELRLRLEAAIKTADDEAVLQVPELVVPELYAAVAGIRVESLFYNYS ML |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | STYK1 |
Synonyms | STYK1; NOK; Tyrosine-protein kinase STYK1; Novel oncogene with kinase domain; Protein PK-unique; Serine/threonine/tyrosine kinase 1 |
UniProt ID | Q6J9G0 |
◆ Recombinant Proteins | ||
RFL19274MF | Recombinant Full Length Mouse Tyrosine-Protein Kinase Styk1(Styk1) Protein, His-Tagged | +Inquiry |
STYK1-3038H | Recombinant Human STYK1, GST-tagged | +Inquiry |
STYK1-4369R | Recombinant Rhesus Macaque STYK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
STYK1-16203M | Recombinant Mouse STYK1 Protein | +Inquiry |
STYK1-7023H | Recombinant Human STYK1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STYK1-1371HCL | Recombinant Human STYK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STYK1 Products
Required fields are marked with *
My Review for All STYK1 Products
Required fields are marked with *
0
Inquiry Basket