Recombinant Full Length Human Transmembrane Protein 68(Tmem68) Protein, His-Tagged
Cat.No. : | RFL12422HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 68(TMEM68) Protein (Q96MH6) (1-324aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-324) |
Form : | Lyophilized powder |
AA Sequence : | MIDKNQTCGVGQDSVPYMICLIHILEEWFGVEQLEDYLNFANYLLWVFTPLILLILPYFT IFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGARKTVATLWDGHAAVWHGYEVHGMEKIPE DGPALIIFYHGAIPIDFYYFMAKIFIHKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPR EKCVEILRSGHLLAISPGGVREALISDETYNIVWGHRRGFAQVAIDAKVPIIPMFTQNIR EGFRSLGGTRLFRWLYEKFRYPFAPMYGGFPVKLRTYLGDPIPYDPQITAEELAEKTKNA VQALIDKHQRIPGNIMSALLERFH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM68 |
Synonyms | TMEM68; Transmembrane protein 68 |
UniProt ID | Q96MH6 |
◆ Native Proteins | ||
ALB-5363B | Native Bovine Albumin | +Inquiry |
APOB-216H | Native Human APOB Protein | +Inquiry |
Lectin-1820P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Fluorescein labeled | +Inquiry |
LTF-4771H | Native Human Lactotransferrin | +Inquiry |
IgA-130H | Native Human Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP5J-8597HCL | Recombinant Human ATP5J 293 Cell Lysate | +Inquiry |
HA-2548HCL | Recombinant H7N7 HA cell lysate | +Inquiry |
CPLX3-777HCL | Recombinant Human CPLX3 cell lysate | +Inquiry |
MOBKL2A-4265HCL | Recombinant Human MOBKL2A 293 Cell Lysate | +Inquiry |
RAB7B-2582HCL | Recombinant Human RAB7B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TMEM68 Products
Required fields are marked with *
My Review for All TMEM68 Products
Required fields are marked with *
0
Inquiry Basket