Recombinant Full Length Human Transmembrane Protein 184B(Tmem184B) Protein, His-Tagged
Cat.No. : | RFL11576HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 184B(TMEM184B) Protein (Q9Y519) (1-407aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-407) |
Form : | Lyophilized powder |
AA Sequence : | MTVRGDVLAPDPASPTTAAASPSVSVIPEGSPTAMEQPVFLMTTAAQAISGFFVWTALLI TCHQIYMHLRCYSCPNEQRYIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGTVRDCYEA LVIYNFLSLCYEYLGGESSIMSEIRGKPIESSCMYGTCCLWGKTYSIGFLRFCKQATLQF CVVKPLMAVSTVVLQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATRELL SPYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKIHSARVSVGEGTVAAGYQDFIIC VEMFFAALALRHAFTYKVYADKRLDAQGRCAPMKSISSSLKETMNPHDIVQDAIHNFSPA YQQYTQQSTLEPGPTWRGGAHGLSRSHSLSGARDNEKTLLLSSDDEF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM184B |
Synonyms | TMEM184B; C22orf5; PSEC0108; Transmembrane protein 184B; Putative MAPK-activating protein FM08 |
UniProt ID | Q9Y519 |
◆ Recombinant Proteins | ||
CXCL9-4352R | Recombinant Rabbit CXCL9 Protein | +Inquiry |
ADAMTSL1-7361H | Recombinant Human ADAMTSL1 protein, His-tagged | +Inquiry |
RFL33023SF | Recombinant Full Length Shewanella Denitrificans Atp Synthase Subunit C(Atpe) Protein, His-Tagged | +Inquiry |
CFL2-11143H | Recombinant Human CFL2, GST-tagged | +Inquiry |
RBCK1-2203H | Recombinant Human RBCK1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GHRH-37H | Active Native Human GHRH | +Inquiry |
LOX3-11S | Native Soybeans LOX3 Protein | +Inquiry |
PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
C7-56H | Native Human Complement C7 | +Inquiry |
MB-4460H | Native Human Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPK-5443HCL | Recombinant Human HNRNPK 293 Cell Lysate | +Inquiry |
SNX16-1598HCL | Recombinant Human SNX16 293 Cell Lysate | +Inquiry |
NRIP2-441HCL | Recombinant Human NRIP2 lysate | +Inquiry |
ZNF137P-1988HCL | Recombinant Human ZNF137P cell lysate | +Inquiry |
CUL1-7185HCL | Recombinant Human CUL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM184B Products
Required fields are marked with *
My Review for All TMEM184B Products
Required fields are marked with *
0
Inquiry Basket