Recombinant Full Length Human Transmembrane And Coiled-Coil Domain-Containing Protein 1(Tmco1) Protein, His-Tagged
Cat.No. : | RFL1638HF |
Product Overview : | Recombinant Full Length Human Transmembrane and coiled-coil domain-containing protein 1(TMCO1) Protein (Q9UM00) (1-188aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-188) |
Form : | Lyophilized powder |
AA Sequence : | MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITES AGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFT PLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGP PPPSGKFS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMCO1 |
Synonyms | TMCO1; TMCC4; PNAS-10; PNAS-136; UNQ151/PRO177; Calcium load-activated calcium channel; CLAC channel; Transmembrane and coiled-coil domain-containing protein 1; Transmembrane and coiled-coil domains protein 4; Xenogeneic cross-immune protein PCIA3 |
UniProt ID | Q9UM00 |
◆ Recombinant Proteins | ||
TMCO1-5752R | Recombinant Rat TMCO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL18743DF | Recombinant Full Length Dictyostelium Discoideum Transmembrane And Coiled-Coil Domain-Containing Protein 1 Homolog(Tmco1) Protein, His-Tagged | +Inquiry |
TMCO1-6095R | Recombinant Rat TMCO1 Protein | +Inquiry |
Tmco1-6460M | Recombinant Mouse Tmco1 Protein, Myc/DDK-tagged | +Inquiry |
TMCO1-693Z | Recombinant Zebrafish TMCO1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMCO1-1027HCL | Recombinant Human TMCO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMCO1 Products
Required fields are marked with *
My Review for All TMCO1 Products
Required fields are marked with *
0
Inquiry Basket