Recombinant Full Length Human TPPP3 Protein, GST-tagged
Cat.No. : | TPPP3-3548HF |
Product Overview : | Human TPPP3 full-length ORF (NP_057048.2, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 176 amino acids |
Description : | TPPP3 (Tubulin Polymerization Promoting Protein Family Member 3) is a Protein Coding gene. Diseases associated with TPPP3 include Cerebrospinal Fluid Leak and Creutzfeldt-Jakob Disease. GO annotations related to this gene include tubulin binding. An important paralog of this gene is TPPP. |
Molecular Mass : | 45.4 kDa |
AA Sequence : | MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TPPP3 tubulin polymerization-promoting protein family member 3 [Homo sapiens (human) ] |
Official Symbol | TPPP3 |
Synonyms | TPPP3; p20; CGI-38; p25gamma; tubulin polymerization-promoting protein family member 3; TPPP/p20; brain specific protein |
Gene ID | 51673 |
mRNA Refseq | NM_015964 |
Protein Refseq | NP_057048 |
MIM | 616957 |
UniProt ID | Q9BW30 |
◆ Recombinant Proteins | ||
TPPP3-17266M | Recombinant Mouse TPPP3 Protein | +Inquiry |
TPPP3-15873H | Recombinant Human TPPP3, His-tagged | +Inquiry |
TPPP3-2429H | Recombinant Human TPPP3 Protein, MYC/DDK-tagged | +Inquiry |
TPPP3-4922R | Recombinant Rhesus monkey TPPP3 Protein, His-tagged | +Inquiry |
TPPP3-4736R | Recombinant Rhesus Macaque TPPP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPPP3-343HCL | Recombinant Human TPPP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TPPP3 Products
Required fields are marked with *
My Review for All TPPP3 Products
Required fields are marked with *
0
Inquiry Basket