Recombinant Full Length Human TPPP3 Protein, GST-tagged

• Cat.No.: TPPP3-3548HF
• Product Overview: Human TPPP3 full-length ORF (NP_057048.2, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: TPPP3 (Tubulin Polymerization Promoting Protein Family Member 3) is a Protein Coding gene. Diseases associated with TPPP3 include Cerebrospinal Fluid Leak and Creutzfeldt-Jakob Disease. GO annotations related to this gene include tubulin binding. An important paralog of this gene is TPPP.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 45.4 kDa
• Protein length: 176 amino acids
• AA Sequence: MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TPPP3 tubulin polymerization-promoting protein family member 3 [Homo sapiens (human) ]
• Official Symbol: TPPP3
• Synonyms: TPPP3; p20; CGI-38; p25gamma; tubulin polymerization-promoting protein family member 3; TPPP/p20; brain specific protein
• Gene ID: 51673
• mRNA Refseq: NM_015964
• Protein Refseq: NP_057048
• MIM: 616957
• UniProt ID: Q9BW30