Recombinant Full Length Human TPH2 Protein, C-Flag-tagged
Cat.No. : | TPH2-1148HFL |
Product Overview : | Recombinant Full Length Human TPH2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the pterin-dependent aromatic acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. Mutations in this gene may be associated with psychiatric diseases such as bipolar affective disorder and major depression. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.9 kDa |
AA Sequence : | MQPAMMMFSSKYWARRGFSLDSAVPEEHQLLGSSTLNKPNSGKNDDKGNKGSSKREAATESGKTAVVFSL KNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSSEVEIFVDCECGKTEFNELIQLLKFQTTIVTLNPPEN IWTEEEELEDVPWFPRKISELDKCSHRVLMYGSELDADHPGFKDNVYRQRRKYFVDVAMGYKYGQPIPRV EYTEEETKTWGVVFRELSKLYPTHACREYLKNFPLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAG YLSPRDFLAGLAYRVFHCTQYIRHGSDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDED VQKLATCYFFTIEFGLCKQEGQLRAYGAGLLSSIGELKHALSDKACVKAFDPKTTCLQECLITTFQEAYF VSESFEEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLGITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Tryptophan metabolism |
Full Length : | Full L. |
Gene Name | TPH2 tryptophan hydroxylase 2 [ Homo sapiens (human) ] |
Official Symbol | TPH2 |
Synonyms | NTPH; ADHD7 |
Gene ID | 121278 |
mRNA Refseq | NM_173353.4 |
Protein Refseq | NP_775489.2 |
MIM | 607478 |
UniProt ID | Q8IWU9 |
◆ Recombinant Proteins | ||
TPH2-2024H | Recombinant Human TPH2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TPH2-4918R | Recombinant Rhesus monkey TPH2 Protein, His-tagged | +Inquiry |
TPH2-17253M | Recombinant Mouse TPH2 Protein | +Inquiry |
TPH2-5897R | Recombinant Rat TPH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TPH2-4732R | Recombinant Rhesus Macaque TPH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPH2-699HCL | Recombinant Human TPH2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TPH2 Products
Required fields are marked with *
My Review for All TPH2 Products
Required fields are marked with *
0
Inquiry Basket