Recombinant Full Length Human TNFSF4 Protein, C-Flag-tagged
Cat.No. : | TNFSF4-1935HFL |
Product Overview : | Recombinant Full Length Human TNFSF4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 20.9 kDa |
AA Sequence : | MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYK KEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMV ASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Cytokine-cytokine receptor interaction |
Full Length : | Full L. |
Gene Name | TNFSF4 TNF superfamily member 4 [ Homo sapiens (human) ] |
Official Symbol | TNFSF4 |
Synonyms | GP34; CD252; OX4OL; TXGP1; CD134L; OX-40L; TNLG2B |
Gene ID | 7292 |
mRNA Refseq | NM_003326.5 |
Protein Refseq | NP_003317.1 |
MIM | 603594 |
UniProt ID | P23510 |
◆ Recombinant Proteins | ||
TNFSF4-5542M | Recombinant Rhesus macaque TNFSF4 Protein (Gln51-Leu183), N-His tagged | +Inquiry |
TNFSF4-490HAF488 | Recombinant Human TNFSF4 Protein, hFc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
TNFSF4-490HAF647 | Recombinant Human TNFSF4 Protein, hFc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
TNFSF4-344H | Active Recombinant Human TNFSF4 protein, mFc-tagged | +Inquiry |
TNFSF4-0590H | Active Recombinant Human TNFSF4 protein, Avi-Fc-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF4-857CCL | Recombinant Cynomolgus TNFSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF4 Products
Required fields are marked with *
My Review for All TNFSF4 Products
Required fields are marked with *
0
Inquiry Basket