Recombinant Full Length Human TMEM258 Protein, GST-tagged

Cat.No. : TMEM258-1795HF
Product Overview : Human TMEM258 full-length ORF (NP_055021.1, 1 a.a. - 79 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
ProteinLength : 79 amino acids
Description : Involved in protein N-linked glycosylation. Located in endoplasmic reticulum. Part of oligosaccharyltransferase I complex.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.09 kDa
AA Sequence : MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TMEM258 transmembrane protein 258 [ Homo sapiens (human) ]
Official Symbol TMEM258
Synonyms C11orf10; Kuduk; Kud; Dolichyl-Diphosphooligosaccharide-Protein Glycosyltransferase Subunit TMEM258; Oligosaccharyl Transferase Subunit TMEM258; UPF0197 Transmembrane Protein C11orf10; Chromosome 11 Open Reading Frame 10
Gene ID 746
mRNA Refseq NM_014206.3
Protein Refseq NP_055021.1
MIM 617615
UniProt ID P61165

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TMEM258 Products

Required fields are marked with *

My Review for All TMEM258 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon