Recombinant Full Length Human TMEM258 Protein, GST-tagged
Cat.No. : | TMEM258-1795HF |
Product Overview : | Human TMEM258 full-length ORF (NP_055021.1, 1 a.a. - 79 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
ProteinLength : | 79 amino acids |
Description : | Involved in protein N-linked glycosylation. Located in endoplasmic reticulum. Part of oligosaccharyltransferase I complex. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 35.09 kDa |
AA Sequence : | MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TMEM258 transmembrane protein 258 [ Homo sapiens (human) ] |
Official Symbol | TMEM258 |
Synonyms | C11orf10; Kuduk; Kud; Dolichyl-Diphosphooligosaccharide-Protein Glycosyltransferase Subunit TMEM258; Oligosaccharyl Transferase Subunit TMEM258; UPF0197 Transmembrane Protein C11orf10; Chromosome 11 Open Reading Frame 10 |
Gene ID | 746 |
mRNA Refseq | NM_014206.3 |
Protein Refseq | NP_055021.1 |
MIM | 617615 |
UniProt ID | P61165 |
◆ Recombinant Proteins | ||
SAOUHSC-00499-3677S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_00499 protein, His-tagged | +Inquiry |
CD200-2059H | Recombinant Human CD200 protein, His-tagged | +Inquiry |
RFL1092SF | Recombinant Full Length Shigella Boydii Serotype 4 Rhomboid Protease Glpg(Glpg) Protein, His-Tagged | +Inquiry |
DEPDC1B-2333M | Recombinant Mouse DEPDC1B Protein, His (Fc)-Avi-tagged | +Inquiry |
Arsb-653M | Recombinant Mouse Arsb Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
IgG2A-015M | Native Mouse IgG2A Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
HPIV3ag-275V | Active Native Parainfluenza Virus type 3(strain III v 2932) Protein | +Inquiry |
IgG-217H | Native Human Immunoglobulin G (IgG) | +Inquiry |
Lectin-1778G | Active Native Galanthus Nivalis Lectin Protein, Fluorescein labeled | +Inquiry |
Col4-20M | Native Mouse Collagen IV protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FRMPD2B-285HCL | Recombinant Human FRMPD2L2 lysate | +Inquiry |
DSN1-236HCL | Recombinant Human DSN1 lysate | +Inquiry |
TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
MTDH-507HCL | Recombinant Human MTDH cell lysate | +Inquiry |
HINT1-5558HCL | Recombinant Human HINT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TMEM258 Products
Required fields are marked with *
My Review for All TMEM258 Products
Required fields are marked with *
0
Inquiry Basket