Recombinant Full Length Human TMEM102 Protein, C-Flag-tagged
Cat.No. : | TMEM102-1773HFL |
Product Overview : | Recombinant Full Length Human TMEM102 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Involved in regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway; response to cytokine; and signal transduction. Acts upstream of or within positive regulation of T cell migration and positive regulation of cell adhesion. Located in cell surface. Part of protein-containing complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54 kDa |
AA Sequence : | MASAVWGSAPWWGPPPPAPARPLTDIDFCSGAQLQELTQLIQELGVQESWSDGPKPGADLLRAKDFVFSL LGLVHRRDPRFPPQAELLLLRGGIREGSLDLGHAPLGPYARGPHYDAGFTLLVPMFSLDGTELQLDLESC YAQVCLPEMVCGTPIREMWQDCLGPPVPGARDSIHRTESEESSKDWQSSVDQPHSYVTEHEAPVSLEKSP SDVSASESPQHDVVDLGSTAPLKTMSSDVTKAAVESPVPKPSEAREAWPTLCSAQVAAWFFATLAAVAES LIPVPGAPRLVHAARHAGFTTVLLATPEPPRRLLLFDLIPVVSVAGWPEGARSHSWAGPLASESASFYLV PGGGTERPCASAWQLCFARQELALKARIPAPLLQAHAAAQALLRPLVAGTRAAAPYLLRTLLYWACERLP ALYLARPENAGACCLGLLDELGRVLEAGTLPHYFLNGRQLRTGDDSAALLGELARLRGDPARALRAAVEE AKVARKGGGLAGVGGGAH myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | TMEM102 transmembrane protein 102 [ Homo sapiens (human) ] |
Official Symbol | TMEM102 |
Synonyms | CBAP |
Gene ID | 284114 |
mRNA Refseq | NM_178518.3 |
Protein Refseq | NP_848613.1 |
MIM | 613936 |
UniProt ID | Q8N9M5 |
◆ Recombinant Proteins | ||
TMEM102-297H | Recombinant Human TMEM102 Protein, MYC/DDK-tagged | +Inquiry |
TMEM102-2206H | Recombinant Human TMEM102 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tmem102-6466M | Recombinant Mouse Tmem102 Protein, Myc/DDK-tagged | +Inquiry |
TMEM102-9275M | Recombinant Mouse TMEM102 Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM102-6072H | Recombinant Human TMEM102 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM102 Products
Required fields are marked with *
My Review for All TMEM102 Products
Required fields are marked with *
0
Inquiry Basket