Recombinant Full Length Human TGFB3 Protein, C-Flag-tagged
Cat.No. : | TGFB3-1865HFL |
Product Overview : | Recombinant Full Length Human TGFB3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. This protein is involved in embryogenesis and cell differentiation, and may play a role in wound healing. Mutations in this gene are a cause of aortic aneurysms and dissections, as well as familial arrhythmogenic right ventricular dysplasia 1. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.7 kDa |
AA Sequence : | MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPTVMTHVPYQVL ALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFNVSSVE KNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEWLSFDVTDTVRE WLLRRESNLGLEISIHCPCHTFQPNGDILENIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLIL MMIPPHRLDNPGQGGQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPY LRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways : | Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Cytokine-cytokine receptor interaction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma, TGF-beta signaling pathway |
Full Length : | Full L. |
Gene Name | TGFB3 transforming growth factor beta 3 [ Homo sapiens (human) ] |
Official Symbol | TGFB3 |
Synonyms | ARVD; LDS5; RNHF; ARVD1; TGF-beta3 |
Gene ID | 7043 |
mRNA Refseq | NM_003239.5 |
Protein Refseq | NP_003230.1 |
MIM | 190230 |
UniProt ID | P10600 |
◆ Recombinant Proteins | ||
TGFB3-17H | Recombinant Human TGFB3 protein | +Inquiry |
TGFB3-2764H | Recombinant Human TGFB3 Protein, His-tagged | +Inquiry |
TGFB3-017H | Active Recombinant Human TGFB3 Protein | +Inquiry |
TGFB3-2165H | Active Recombinant Human TGFB3 protein | +Inquiry |
TGFB3-1865HFL | Recombinant Full Length Human TGFB3 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFB3-1118HCL | Recombinant Human TGFB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGFB3 Products
Required fields are marked with *
My Review for All TGFB3 Products
Required fields are marked with *
0
Inquiry Basket