Recombinant Full Length Human TCEA1 Protein
Cat.No. : | TCEA1-519HF |
Product Overview : | Recombinant full length Human TCEA1 with N terminal proprietary tag; Predicted MWt 59.18 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
ProteinLength : | 301 amino acids |
Description : | Transcription elongation factor A protein 1 is a protein that in humans is encoded by the TCEA1 gene. |
Form : | Liquid |
Molecular Mass : | 59.180kDa inclusive of tags |
AA Sequence : | MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLEL LQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGP STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDET NARDTYVSSFPRAPSTSDSVRLKCREMLAAALRTGDDYIA IGADEEELGSQIEEAIYQEIRNTDMKYKNRVRSRISNLKD AKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNL TKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRS ADEPMTTFVVCNECGNRWKFC |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | TCEA1 transcription elongation factor A (SII), 1 [ Homo sapiens ] |
Official Symbol | TCEA1 |
Synonyms | TCEA1; transcription elongation factor A (SII), 1; GTF2S, TCEA; transcription elongation factor A protein 1; SII; TF2S; TFIIS |
Gene ID | 6917 |
mRNA Refseq | NM_006756 |
Protein Refseq | NP_006747 |
MIM | 601425 |
UniProt ID | P23193 |
◆ Recombinant Proteins | ||
Apoc4-1855M | Recombinant Mouse Apoc4 protein, His & GST-tagged | +Inquiry |
BAK1-337R | Recombinant Rhesus Macaque BAK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
E-1815J | Recombinant JEV E (ΔTM) Protein | +Inquiry |
Hps4-3436M | Recombinant Mouse Hps4 Protein, Myc/DDK-tagged | +Inquiry |
RNF185-5078R | Recombinant Rat RNF185 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1789G | Active Native Griffonia Simplicifolia Lectin II Protein, Fluorescein labeled | +Inquiry |
SERPINC1-8032H | Native Human Plasma AntiThromblin III | +Inquiry |
GPT-1840H | Active Native Human GPT | +Inquiry |
Lectin-1844S | Active Native Solanum Tuberosum Lectin Protein | +Inquiry |
LDH-227H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
◆ Cell & Tissue Lysates | ||
FN3KRP-6176HCL | Recombinant Human FN3KRP 293 Cell Lysate | +Inquiry |
MXD3-4047HCL | Recombinant Human MXD3 293 Cell Lysate | +Inquiry |
PGA5-1338HCL | Recombinant Human PGA5 cell lysate | +Inquiry |
ELP3-551HCL | Recombinant Human ELP3 cell lysate | +Inquiry |
TBK1-1745HCL | Recombinant Human TBK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TCEA1 Products
Required fields are marked with *
My Review for All TCEA1 Products
Required fields are marked with *
0
Inquiry Basket