Recombinant Full Length Human TAZ Protein

• Cat.No.: TAZ-522HF
• Product Overview: Recombinant full length Human Tafazzin/TAZ protein with an N terminal proprietary tag; predicted mwt: 54.56 kDa with the tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 262 amino acids
• Description: This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known.
• Form: Liquid
• Molecular Mass: 54.560kDa inclusive of tags
• AA Sequence: MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTSEWA QAEAGPPGYPCPAGGILKLRHIWNLKLMRWTPAAADICFT KELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWV HIFPEGIGRLIAECHLNPIILPLWHVGEPGDGDREMASGV GGLGLPLVPGCPAPPHVWPSVHCAAGMNDVLPNSPPYFPR FGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFI QEEFQHLKTQAEQLHNHLQPGR
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: TAZ tafazzin [ Homo sapiens ]
• Official Symbol: TAZ
• Synonyms: TAZ; tafazzin; cardiomyopathy, dilated 3A (X linked) , CMD3A, EFE, EFE2, endocardial fibroelastosis 2; Barth syndrome; BTHS; G4.5; XAP 2
• Gene ID: 6901
• mRNA Refseq: NM_000116
• Protein Refseq: NP_000107
• MIM: 300394
• UniProt ID: Q16635