Recombinant Full Length Human TACSTD2 Protein, C-Flag-tagged
Cat.No. : | TACSTD2-479HFL |
Product Overview : | Recombinant Full Length Human TACSTD2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35.5 kDa |
AA Sequence : | MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLT SKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGD LSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTS QKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAV IVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | TACSTD2 tumor associated calcium signal transducer 2 [ Homo sapiens (human) ] |
Official Symbol | TACSTD2 |
Synonyms | EGP1; GP50; M1S1; EGP-1; TROP2; GA7331; GA733-1 |
Gene ID | 4070 |
mRNA Refseq | NM_002353.3 |
Protein Refseq | NP_002344.2 |
MIM | 137290 |
UniProt ID | P09758 |
◆ Recombinant Proteins | ||
TACSTD2-141H | Recombinant Human tumor-associated calcium signal transducer 2 Protein, His tagged | +Inquiry |
TACSTD2-1694H | Recombinant Human Tumor-associated Calcium Signal Transducer 2 | +Inquiry |
TACSTD2-110H | Recombinant Human TACSTD2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
TACSTD2-5053C | Recombinant Chicken TACSTD2 | +Inquiry |
TACSTD2-971R | Recombinant Rat TACSTD2 Protein (Met1-Gly270), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TACSTD2-1630MCL | Recombinant Mouse TACSTD2 cell lysate | +Inquiry |
TACSTD2-2546HCL | Recombinant Human TACSTD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TACSTD2 Products
Required fields are marked with *
My Review for All TACSTD2 Products
Required fields are marked with *
0
Inquiry Basket