Recombinant Full Length Human SSNA1 Protein, C-Flag-tagged
Cat.No. : | SSNA1-1635HFL |
Product Overview : | Recombinant Full Length Human SSNA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Enables identical protein binding activity. Predicted to act upstream of or within ciliary receptor clustering involved in smoothened signaling pathway and intraciliary transport. Located in centrosome. |
Source : | Mammalian cells |
Species : | Human |
Tag : | Flag |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 13.4 kDa |
AA Sequence : | MTQQGAALQNYNNELVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNENLARKIASRNEFDRTIAETEAAYLKILESSQTLLSVLKREAGNLTKATAPDQKSSGGRDS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | SSNA1 SS nuclear autoantigen 1 [ Homo sapiens (human) ] |
Official Symbol | SSNA1 |
Synonyms | N14; NA14; NA-14 |
Gene ID | 8636 |
mRNA Refseq | NM_003731.3 |
Protein Refseq | NP_003722.2 |
MIM | 610882 |
UniProt ID | O43805 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SSNA1 Products
Required fields are marked with *
My Review for All SSNA1 Products
Required fields are marked with *
0
Inquiry Basket