Recombinant Full Length Human Sodium/Potassium-Transporting Atpase Subunit Gamma(Fxyd2) Protein, His-Tagged
Cat.No. : | RFL21318HF |
Product Overview : | Recombinant Full Length Human Sodium/potassium-transporting ATPase subunit gamma(FXYD2) Protein (P54710) (1-66aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli expression system |
Species : | Homo sapiens (Human) |
Tag : | His |
Form : | Lyophilized powder |
Protein length : | Full Length (1-66) |
AA Sequence : | MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FXYD2 |
Synonyms | FXYD2; ATP1C; ATP1G1; Sodium/potassium-transporting ATPase subunit gamma; Na(+)/K(+) ATPase subunit gamma; FXYD domain-containing ion transport regulator 2; Sodium pump gamma chain |
UniProt ID | P54710 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All FXYD2 Products
Required fields are marked with *
My Review for All FXYD2 Products
Required fields are marked with *
0
Inquiry Basket