Recombinant Full Length Human SMIM15 Protein, GST-tagged

• Cat.No.: SMIM15-3927HF
• Product Overview: Human C5orf43 full-length ORF (1 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 74 amino acids
• Description: SMIM15 (Small Integral Membrane Protein 15) is a Protein Coding gene.
• Molecular Mass: 34.54 kDa
• AA Sequence: MFDIKAWAEYVVEWAAKDPYGFLTTVILALTPLFLASAVLSWKLAKMIEAREKEQKKKQKRQENIAKAKRLKKD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SMIM15 small integral membrane protein 15 [ Homo sapiens (human) ]
• Official Symbol: SMIM15
• Synonyms: C5orf43; SMIM15; small integral membrane protein 15; small integral membrane protein 15; UPF0542 protein C5orf43
• Gene ID: 643155
• mRNA Refseq: NM_001048249
• Protein Refseq: NP_001041714
• UniProt ID: Q7Z3B0