Recombinant Full Length Human SMIM11A Protein, GST-tagged

• Cat.No.: SMIM11A-4532HF
• Product Overview: Human FAM165B full-length ORF (AAH15596.1, 1 a.a. - 58 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 58 amino acids
• Description: SMIM11A (Small Integral Membrane Protein 11A) is a Protein Coding gene. An important paralog of this gene is SMIM11B.
• Molecular Mass: 32.78 kDa
• AA Sequence: MNWKVLEHVPLLLYILAAKTLILCLTFAGVKMYQRKRLEAKQQKLEAERKKQSEKKDN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SMIM11A small integral membrane protein 11A [ Homo sapiens (human) ]
• Official Symbol: SMIM11A
• Synonyms: SMIM11A; small integral membrane protein 11A; Small Integral Membrane Protein 11A; Family With Sequence Similarity 165, Member B; Small Integral Membrane Protein 11; C21orf51; FAM165B; SMIM11; Chromosome 21 Open Reading Frame 51; Protein FAM165B; SMIM11B; small integral membrane protein 11A; family with sequence similarity 165, member B; protein FAM165B; small integral membrane protein 11
• Gene ID: 54065
• mRNA Refseq: NM_058182
• Protein Refseq: NP_478062
• UniProt ID: P58511