Recombinant Full Length Human SMIM11A Protein, GST-tagged

Cat.No. : SMIM11A-4532HF
Product Overview : Human FAM165B full-length ORF (AAH15596.1, 1 a.a. - 58 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
ProteinLength : 58 amino acids
Description : SMIM11A (Small Integral Membrane Protein 11A) is a Protein Coding gene. An important paralog of this gene is SMIM11B.
Molecular Mass : 32.78 kDa
AA Sequence : MNWKVLEHVPLLLYILAAKTLILCLTFAGVKMYQRKRLEAKQQKLEAERKKQSEKKDN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SMIM11A small integral membrane protein 11A [ Homo sapiens (human) ]
Official Symbol SMIM11A
Synonyms SMIM11A; small integral membrane protein 11A; Small Integral Membrane Protein 11A; Family With Sequence Similarity 165, Member B; Small Integral Membrane Protein 11; C21orf51; FAM165B; SMIM11; Chromosome 21 Open Reading Frame 51; Protein FAM165B; SMIM11B; small integral membrane protein 11A; family with sequence similarity 165, member B; protein FAM165B; small integral membrane protein 11
Gene ID 54065
mRNA Refseq NM_058182
Protein Refseq NP_478062
UniProt ID P58511

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SMIM11A Products

Required fields are marked with *

My Review for All SMIM11A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon