Recombinant Full Length Human SMCP Protein, GST-tagged

Description :	Sperm mitochondria differ in morphology and subcellular localization from those of somatic cells. They are elongated, flattened, and arranged circumferentially to form a helical coiled sheath in the midpiece of the sperm flagellum. The protein encoded by this gene localizes to the capsule associated with the mitochondrial outer membranes and is thought to function in the organization and stabilization of the helical structure of the sperms mitochondrial sheath. [provided by RefSeq
Source :	In Vitro Cell Free System
Species :	Human
Tag :	GST
Molecular Mass :	38.50 kDa
Protein length :	116 amino acids
AA Sequence :	MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	SMCP sperm mitochondria-associated cysteine-rich protein [ Homo sapiens ]
Official Symbol	SMCP
Synonyms	SMCP; sperm mitochondria-associated cysteine-rich protein; MCSP, mitochondrial capsule selenoprotein; sperm mitochondrial-associated cysteine-rich protein; mitochondrial capsule selenoprotein; MCS; MCSP; HSMCSGEN1; MGC26305; MGC26519;
Gene ID	4184
mRNA Refseq	NM_030663
Protein Refseq	NP_109588
MIM	601148
UniProt ID	P49901