Recombinant Full Length Human SCAMP3 Protein, C-Flag-tagged
Cat.No. : | SCAMP3-1639HFL |
Product Overview : | Recombinant Full Length Human SCAMP3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an integral membrane protein that belongs to the secretory carrier membrane protein family. The encoded protein functions as a carrier to the cell surface in post-golgi recycling pathways. This protein is also involved in protein trafficking in endosomal pathways. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.1 kDa |
AA Sequence : | MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQ PSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPS FCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLASFCVETNNGAGFGLSILWVLLFT PCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLML LVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSNPAVRTAAANAAAGAAENAFRAPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | SCAMP3 secretory carrier membrane protein 3 [ Homo sapiens (human) ] |
Official Symbol | SCAMP3 |
Synonyms | C1orf3 |
Gene ID | 10067 |
mRNA Refseq | NM_005698.4 |
Protein Refseq | NP_005689.2 |
MIM | 606913 |
UniProt ID | O14828 |
◆ Recombinant Proteins | ||
SCAMP3-2063H | Recombinant Human SCAMP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SCAMP3-2521H | Recombinant Human SCAMP3, GST-tagged | +Inquiry |
SCAMP3-1734Z | Recombinant Zebrafish SCAMP3 | +Inquiry |
RFL5645AF | Recombinant Full Length Arabidopsis Thaliana Secretory Carrier-Associated Membrane Protein 3(Scamp3) Protein, His-Tagged | +Inquiry |
SCAMP3-5219H | Recombinant Human SCAMP3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCAMP3-2048HCL | Recombinant Human SCAMP3 293 Cell Lysate | +Inquiry |
SCAMP3-2047HCL | Recombinant Human SCAMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCAMP3 Products
Required fields are marked with *
My Review for All SCAMP3 Products
Required fields are marked with *
0
Inquiry Basket