Recombinant Full Length Human RTN1 Protein
Cat.No. : | RTN1-450HF |
Product Overview : | Recombinant full length Human Reticulon 1 Isoform 3 with an N-terminal proprietary tag; predicted MWt 48.99 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 208 amino acids |
Description : | This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. This gene is considered to be a specific marker for neurological diseases and cancer, and is a potential molecular target for therapy. Alternative splicing results in multiple transcript variants. |
Form : | Liquid |
Molecular Mass : | 48.990kDa inclusive of tags |
AA Sequence : | MQATADSTKMDCVWSNWKSQAIDLLYWRDIKQTGIVFGSF LLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAV QKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLK ELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMA VVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKI PGAKRHAE |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | RTN1 reticulon 1 [ Homo sapiens ] |
Official Symbol | RTN1 |
Synonyms | RTN1; reticulon 1; neuroendocrine specific protein , NSP; reticulon-1 |
Gene ID | 6252 |
mRNA Refseq | NM_021136 |
Protein Refseq | NP_066959 |
MIM | 600865 |
UniProt ID | Q16799 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RTN1 Products
Required fields are marked with *
My Review for All RTN1 Products
Required fields are marked with *
0
Inquiry Basket