Recombinant Full Length Human RPS2P32 Protein, GST-tagged

• Cat.No.: RPS2P32-6173HF
• Product Overview: Human MGC27348 full-length ORF ( AAH26177.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 172 amino acids
• Description: RPS2P32 (Ribosomal Protein S2 Pseudogene 32) is a Pseudogene.
• Molecular Mass: 46.1 kDa
• AA Sequence: MKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVRKETRAGQRTRFKAFVAIRDYNGYAGRVEVLQGGGRRHPRGHHPDQALHCHRAQRLLGEQDRQAPHRPLQGDRPLRLCAGALHPRAQGHWHRLSSCAQEAAHDSWYLRLLHLSQGLHCHPGQLRQRHLGCCL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RPS2P32 ribosomal protein S2 pseudogene 32 [ Homo sapiens (human) ]
• Official Symbol: RPS2P32
• Synonyms: RPS2P32; ribosomal protein S2 pseudogene 32; RPS2_14_794
• Gene ID: 256355