Recombinant Full Length Human RIDA Protein, C-Flag-tagged

• Cat.No.: RIDA-1678HFL
• Product Overview: Recombinant Full Length Human RIDA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Enables 2-iminobutanoate deaminase activity and mRNA binding activity. Involved in mRNA catabolic process; mRNA destabilization; and organonitrogen compound catabolic process. Located in cytoplasm and nucleus.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 14.3 kDa
• AA Sequence: MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAG CDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGPLTTASLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: RIDA reactive intermediate imine deaminase A homolog [ Homo sapiens (human) ]
• Official Symbol: RIDA
• Synonyms: PSP; P14.5; UK114; HRSP12; hp14.5
• Gene ID: 10247
• mRNA Refseq: NM_005836.3
• Protein Refseq: NP_005827.1
• MIM: 602487
• UniProt ID: P52758