Recombinant Full Length Human RHOT2 Protein, C-Flag-tagged
Cat.No. : | RHOT2-1423HFL |
Product Overview : | Recombinant Full Length Human RHOT2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the Rho family of GTPases. The encoded protein is localized to the outer mitochondrial membrane and plays a role in mitochondrial trafficking and fusion-fission dynamics. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 67.9 kDa |
AA Sequence : | MRRDVRILLLGEAQVGKTSLILSLVGEEFPEEVPPRAEEITIPADVTPEKVPTHIVDYSEAEQTDEELRE EIHKANVVCVVYDVSEEATIEKIRTKWIPLVNGGTTQGPRVPIILVGNKSDLRSGSSMEAVLPIMSQFPE IETCVECSAKNLRNISELFYYAQKAVLHPTAPLYDPEAKQLRPACAQALTRIFRLSDQDLDQALSDEELN AFQKSCFGHPLAPQALEDVKTVVCRNVAGGVREDRLTLDGFLFLNTLFIQRGRHETTWTILRRFGYSDAL ELTADYLSPLIHVPPGCSTELNHLGYQFVQRVFEKHDQDRDGALSPVELQSLFSVFPAAPWGPELPRTVR TEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCK VVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVAC LMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPA EPSTTIFTQLATMAAFPHLVHAELHPSSFWLRGLLGVVGAAVAAVLSFSLYRVLVKSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | RHOT2 ras homolog family member T2 [ Homo sapiens (human) ] |
Official Symbol | RHOT2 |
Synonyms | RASL; ARHT2; MIRO2; MIRO-2; C16orf39 |
Gene ID | 89941 |
mRNA Refseq | NM_138769.3 |
Protein Refseq | NP_620124.1 |
MIM | 613889 |
UniProt ID | Q8IXI1 |
◆ Recombinant Proteins | ||
RHOT2-7593M | Recombinant Mouse RHOT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RHOT2-1176H | Recombinant Human RHOT2 Protein, MYC/DDK-tagged | +Inquiry |
RHOT2-14179M | Recombinant Mouse RHOT2 Protein | +Inquiry |
RHOT2-30983TH | Recombinant Human RHOT2, His-tagged | +Inquiry |
RHOT2-4697R | Recombinant Rat RHOT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOT2-1507HCL | Recombinant Human RHOT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RHOT2 Products
Required fields are marked with *
My Review for All RHOT2 Products
Required fields are marked with *
0
Inquiry Basket