Recombinant Full Length Human Putative Uncharacterized Protein Flj37107 Protein, His-Tagged
Cat.No. : | RFL33509HF |
Product Overview : | Recombinant Full Length Human Putative uncharacterized protein FLJ37107 Protein (Q8N9I1) (1-131aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-131) |
Form : | Lyophilized powder |
AA Sequence : | MFLGLVGLRTKGRRWISSWSEGEDRGQSPEGVLLTWVFGTKCVMHPCEETTKQALCEQQG CLFHLGADELSPKRESAQSISFKWENSIYLHATLFLIGEYLHLAFYYFLLVLYILCSFLS YCLLLWLGSFL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Putative uncharacterized protein FLJ37107 |
UniProt ID | Q8N9I1 |
◆ Recombinant Proteins | ||
CCL19-151H | Recombinant Human CCL19 Protein, His-tagged | +Inquiry |
ANKRD42-598H | Recombinant Human ANKRD42 protein, GST-tagged | +Inquiry |
TPK1-1112HFL | Recombinant Full Length Human TPK1 Protein, C-Flag-tagged | +Inquiry |
ERBB3-114H | Recombinant Human ERBB3 Protein, ECD, Tag Free, Biotinylated | +Inquiry |
ZNF382-10423M | Recombinant Mouse ZNF382 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
C4B-10H | Native Human C4B Protein | +Inquiry |
FGG -48S | Native Sheep Fibrinogen, FITC Labeled | +Inquiry |
Pectin-008A | Native Apple or Citrus fruits Pectin | +Inquiry |
Thrombin-29B | Active Native Bovine alpha-Thrombin-FPRck | +Inquiry |
CP-8073H | Native Human Plasma Ceruloplasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
MELK-4368HCL | Recombinant Human MELK 293 Cell Lysate | +Inquiry |
SPTSSA-8285HCL | Recombinant Human C14orf147 293 Cell Lysate | +Inquiry |
CES5A-2231MCL | Recombinant Mouse CES5A cell lysate | +Inquiry |
USHBP1-727HCL | Recombinant Human USHBP1 lysate | +Inquiry |
ASAP1-8668HCL | Recombinant Human ASAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Putative uncharacterized protein FLJ37107 Products
Required fields are marked with *
My Review for All Putative uncharacterized protein FLJ37107 Products
Required fields are marked with *
0
Inquiry Basket