Recombinant Full Length Human Putative Dimethylaniline Monooxygenase [N-Oxide-Forming] 6(Fmo6P) Protein, His-Tagged
Cat.No. : | RFL35837HF |
Product Overview : | Recombinant Full Length Human Putative dimethylaniline monooxygenase [N-oxide-forming] 6(FMO6P) Protein (O60774) (1-539aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-539) |
Form : | Lyophilized powder |
AA Sequence : | MSKRVGIIGAGVSGLAAIWCCLEEGLEPTCFERSDDVGGLWKFSDHTEEGRASIYQSVFT NSSKEMMCFPDFPYPDDYPNYIHHSKLQEYIKTYAQKKDLLRYIQFETLVSGIKKCPSFL VTGQWVVVTEKDGKQESTIFDAVMICSGHHVYPNLPTDSFPGLDQFRGNYLHSRDYKNPE AFKGKRVLVIGLGNSGSDIAVELSRLATQVIISTRSASWVMSRVWDDGYPWDMMYVTRFA SFLRNVLPSFISDWLYVQKMNTWFKHENYGLMPLNGSLRKEPVFNDELPSRILCGTLSIK PSVKEFTETSAVFEDGTMFEAIDSVIFATGYDYSYPFLDETIMKSRNNEVTLFKGIFPPL MEKPTLAVIGLVQSLGAAIPTADLQAWWAAKVFANSCTLPTTNEMMDDTDEKMGKKLKCM FSSFFMFGQSQTLQTDYITYVDELGSFIGAKPNIPWLFLTDPRLALEVYFGPCSPYQFRL MGPGKWDGARNAILTQWNRTVKPTRTRVVSEVQRPHPFYNLLKMLSFPLLLLAVTLTFY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FMO6P |
Synonyms | FMO6P; FMO6; Putative dimethylaniline monooxygenase [N-oxide-forming] 6; Dimethylaniline oxidase 6; Flavin-containing monooxygenase 6; FMO 6 |
UniProt ID | O60774 |
◆ Native Proteins | ||
Spinal cord-C57M | Mouse Spinal cord whole Lysate, Total Protein | +Inquiry |
F9-5405M | Native Mouse Coagulation Factor IX | +Inquiry |
Tropomyosin-894R | Native Rabbit Tropomyosin Protein | +Inquiry |
H3N2993-216I | Native H3N2 (A/Shandong/9/93) H3N2993 protein | +Inquiry |
PNLIP-8203H | Native Human Pancreatic Lipase | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR38-349HCL | Recombinant Human WDR38 293 Cell Lysate | +Inquiry |
Esophagus-22G | Human Esophagus Tissue Lysate | +Inquiry |
ANXA2-8833HCL | Recombinant Human ANXA2 293 Cell Lysate | +Inquiry |
GBA-6002HCL | Recombinant Human GBA 293 Cell Lysate | +Inquiry |
PRADC1-8064HCL | Recombinant Human C2orf7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FMO6P Products
Required fields are marked with *
My Review for All FMO6P Products
Required fields are marked with *
0
Inquiry Basket