Recombinant Full Length Human PTX3 Protein, C-Flag-tagged
Cat.No. : | PTX3-1457HFL |
Product Overview : | Recombinant Full Length Human PTX3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the pentraxin protein family. The expression of this protein is induced by inflammatory cytokines in response to inflammatory stimuli in several mesenchymal and epithelial cell types, particularly endothelial cells and mononuclear phagocytes. The protein promotes fibrocyte differentiation and is involved in regulating inflammation and complement activation. It also plays a role in angiogenesis and tissue remodeling. The protein serves as a biomarker for several inflammatory conditions. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 41.8 kDa |
AA Sequence : | MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCDCGQEHSEWDKLFIMLENSQMRE RMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDELLQATRDAGRRLARMEGAEAQ RPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCETAILFPMRSKKIFGSVHPVRPMRLESFSAC IWVKATDVLNKTILFSYGTKRNPYEIQLYLSYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGL TSLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRE TGGAESCHIRGNIVGWGVTEIQPHGGAQYVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | PTX3 pentraxin 3 [ Homo sapiens (human) ] |
Official Symbol | PTX3 |
Synonyms | TSG-14; TNFAIP5 |
Gene ID | 5806 |
mRNA Refseq | NM_002852.4 |
Protein Refseq | NP_002843.2 |
MIM | 602492 |
UniProt ID | P26022 |
◆ Recombinant Proteins | ||
PTX3-260H | Recombinant Human pentraxin 3, long Protein, Tag Free | +Inquiry |
PTX3-1940M | Active Recombinant Mouse PTX3 protein, His-tagged | +Inquiry |
Ptx3-01M | Active Recombinant Mouse Ptx3 Protein, His-tagged | +Inquiry |
Ptx3-1777M | Recombinant Mouse Ptx3 protein, His-tagged | +Inquiry |
PTX3-6115H | Recombinant Human PTX3 Protein (Met1-Ser381), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTX3-2102HCL | Recombinant Human PTX3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTX3 Products
Required fields are marked with *
My Review for All PTX3 Products
Required fields are marked with *
0
Inquiry Basket