Recombinant Full Length Human PTPN5 Protein, C-Flag-tagged
Cat.No. : | PTPN5-1106HFL |
Product Overview : | Recombinant Full Length Human PTPN5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables phosphotyrosine residue binding activity. Predicted to be involved in peptidyl-tyrosine dephosphorylation. Predicted to act upstream of or within protein dephosphorylation. Predicted to be located in nucleoplasm. Predicted to be integral component of membrane. Biomarker of Alzheimer's disease. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 63.4 kDa |
AA Sequence : | MNYEGARSERENHAADDSEGGALDMCCSERLPGLPQPIVMEALDEAEGLQDSQREMPPPPPPSPPSDPAQ KPPPRGAGSHSLTVRSSLCLFAASQFLLACGVLWFSGYGHIWSQNATNLVSSLLTLLKQLEPTAWLDSGT WGVPSLLLVFLSVGLVLVTTLVWHLLRTPPEPPTPLPPEDRRQSVSRQPSFTYSEWMEEKIEDDFLDLDP VPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLS ASRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPL SSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYD GVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCA PIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLS HQSPETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Phosphatase, Transmembrane |
Protein Pathways : | MAPK signaling pathway |
Full Length : | Full L. |
Gene Name | PTPN5 protein tyrosine phosphatase non-receptor type 5 [ Homo sapiens (human) ] |
Official Symbol | PTPN5 |
Synonyms | STEP; STEP61; PTPSTEP |
Gene ID | 84867 |
mRNA Refseq | NM_006906.2 |
Protein Refseq | NP_008837.1 |
MIM | 176879 |
UniProt ID | P54829 |
◆ Recombinant Proteins | ||
PTPN5-723H | Recombinant Full Length Human PTPN5 Protein, MYC/DDK-tagged | +Inquiry |
PTPN5-3389H | Recombinant Human PTPN5 protein, His-SUMO-tagged | +Inquiry |
PTPN5-4493R | Recombinant Rat PTPN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTPN5-833H | Recombinant Human PTPN5 Protein, GST-tagged | +Inquiry |
PTPN5-4562H | Recombinant Human PTPN5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPN5-2682HCL | Recombinant Human PTPN5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTPN5 Products
Required fields are marked with *
My Review for All PTPN5 Products
Required fields are marked with *
0
Inquiry Basket