Recombinant Full Length Human PTGES3 Protein (1-160 aa), His-tagged

• Cat.No.: PTGES3-2568H
• Product Overview: Recombinant Human PTGES3 Protein (1-160 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full length.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-160 aa
• Description: Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 21.2 kDa
• AA Sequence: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: PTGES3 prostaglandin E synthase 3 (cytosolic) [ Homo sapiens ]
• Official Symbol: PTGES3
• Synonyms: PTGES3; prostaglandin E synthase 3; cPGES; p23; TEBP; Hsp90 co-chaperone; P23
• Gene ID: 10728
• mRNA Refseq: NM_006601
• Protein Refseq: NP_006592
• MIM: 607061
• UniProt ID: Q15185