Recombinant Full Length Human PSMG3 Protein, GST-tagged

• Cat.No.: PSMG3-6256HF
• Product Overview: Human MGC10911 full-length ORF ( AAH04308, 1 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 122 amino acids
• Description: PSMG3 (Proteasome Assembly Chaperone 3) is a Protein Coding gene.
• Molecular Mass: 39.16 kDa
• AA Sequence: MEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PSMG3 proteasome (prosome, macropain) assembly chaperone 3 [ Homo sapiens ]
• Official Symbol: PSMG3
• Synonyms: PSMG3; proteasome (prosome, macropain) assembly chaperone 3; C7orf48, chromosome 7 open reading frame 48; proteasome assembly chaperone 3; MGC10911; PAC3; PAC-3; hPAC3; proteasome assembling chaperone 3; C7orf48
• Gene ID: 84262
• mRNA Refseq: NM_001134340
• Protein Refseq: NP_001127812
• MIM: 617528
• UniProt ID: Q9BT73