Recombinant Full Length Human PSAT1 Protein, C-Flag-tagged
Cat.No. : | PSAT1-1198HFL |
Product Overview : | Recombinant Full Length Human PSAT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the class-V pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is a phosphoserine aminotransferase and decreased expression may be associated with schizophrenia. Mutations in this gene are also associated with phosphoserine aminotransferase deficiency. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, and 8. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 40.2 kDa |
AA Sequence : | MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNY KVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTW NLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVV IVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYE IIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVT IEDVQKLAAFMKKFLEMHQLSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Glycine, serine and threonine metabolism, Metabolic pathways, Vitamin B6 metabolism |
Full Length : | Full L. |
Gene Name | PSAT1 phosphoserine aminotransferase 1 [ Homo sapiens (human) ] |
Official Symbol | PSAT1 |
Synonyms | PSA; EPIP; NLS2; PSAT; PSATD |
Gene ID | 29968 |
mRNA Refseq | NM_058179.4 |
Protein Refseq | NP_478059.1 |
MIM | 610936 |
UniProt ID | Q9Y617 |
◆ Recombinant Proteins | ||
PSAT1-10199Z | Recombinant Zebrafish PSAT1 | +Inquiry |
PSAT1-1328H | Recombinant Human Phosphoserine Aminotransferase 1, His-tagged | +Inquiry |
PSAT1-4715H | Recombinant Human PSAT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PSAT1-0271H | Recombinant Human PSAT1 Protein (L17-L370), His tagged | +Inquiry |
PSAT1-5837H | Recombinant Human PSAT1 Protein (Met1-Gly312), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSAT1-1424HCL | Recombinant Human PSAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PSAT1 Products
Required fields are marked with *
My Review for All PSAT1 Products
Required fields are marked with *
0
Inquiry Basket