Recombinant Full Length Human PRSS30P Protein, GST-tagged

• Cat.No.: PRSS30P-6433HF
• Product Overview: Human MGC52282 full-length ORF ( Q8IVY7, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 146 amino acids
• Description: PRSS30P (Protease, Serine, 30 Pseudogene) is a Pseudogene.
• Molecular Mass: 41.9 kDa
• AA Sequence: MRPLQGGREDCGRPRHPGRTLAVAGWPVVDLSGACMWGLPHPPTLGAHSRPLLPEGDSGGPLVCPINDTWIQAGIVSWGFGCARPFRPGVYTQVLSYTDWIQRTLAESHSGMSGARPGAPGSHSGTSRSHPVLLLELLTVCLLGSL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PRSS30P protease, serine, 30 pseudogene [ Homo sapiens (human) ]
• Official Symbol: PRSS30P
• Synonyms: PRSS30P; protease, serine, 30 pseudogene; protease, serine, 30 homolog, pseudogene; transmembrane protease, serine 8 homolog, pseudogene; transmembrane protease, serine pseudogene
• Gene ID: 124221