Recombinant Full Length Human Protrudin(Zfyve27) Protein, His-Tagged
Cat.No. : | RFL3178HF |
Product Overview : | Recombinant Full Length Human Protrudin(ZFYVE27) Protein (Q5T4F4) (1-411aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-411) |
Form : | Lyophilized powder |
AA Sequence : | MQTSEREGSGPELSPSVMPEAPLESPPFPTKSPAFDLFNLVLSYKRLEIYLEPLKDAGDG VRYLLRWQMPLCSLLTCLGLNVLFLTLNEGAWYSVGALMISVPALLGYLQEVCRARLPDS ELMRRKYHSVRQEDLQRGRLSRPEAVAEVKSFLIQLEAFLSRLCCTCEAAYRVLHWENPV VSSQFYGALLGTVCMLYLLPLCWVLTLLNSTLFLGNVEFFRVVSEYRASLQQRMNPKQEE HAFESPPPPDVGGKDGLMDSTPALTPTEDLTPGSVEEAEEAEPDEEFKDAIEETHLVVLE DDEGAPCPAEDELALQDNGFLSKNEVLRSKVSRLTERLRKRYPTNNFGNCTGCSATFSVL KKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ZFYVE27 |
Synonyms | ZFYVE27; SPG33; Protrudin; Spastic paraplegia 33 protein; Zinc finger FYVE domain-containing protein 27 |
UniProt ID | Q5T4F4 |
◆ Recombinant Proteins | ||
ZFYVE27-2561H | Recombinant Human ZFYVE27 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZFYVE27-10373M | Recombinant Mouse ZFYVE27 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL4224PF | Recombinant Full Length Pongo Abelii Protrudin(Zfyve27) Protein, His-Tagged | +Inquiry |
RFL15285RF | Recombinant Full Length Rat Protrudin(Zfyve27) Protein, His-Tagged | +Inquiry |
ZFYVE27-3536H | Recombinant Human ZFYVE27 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZFYVE27-173HCL | Recombinant Human ZFYVE27 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZFYVE27 Products
Required fields are marked with *
My Review for All ZFYVE27 Products
Required fields are marked with *
0
Inquiry Basket