Recombinant Full Length Human Protein Fam26E(Fam26E) Protein, His-Tagged
Cat.No. : | RFL26019HF |
Product Overview : | Recombinant Full Length Human Protein FAM26E(FAM26E) Protein (Q8N5C1) (1-309aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-309) |
Form : | Lyophilized powder |
AA Sequence : | MDAFQGILKFFLNQKTVIGYSFMALLTVGSERLFSVVAFKCPCSTENMTYGLVFLFAPAW VLLILGFFLNNRSWRLFTGCCVNPRKIFPRGHSCRFFYVLGQITLSSLVAPVMWLSVALL NGTFYECAMSGTRSSGLLELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQAQSQ ILGWCLICSASFFSLLTTCYARCRSKVSYLQLSFWKTYAQKEKEQLENTFLDYANKLSER NLKCFFENKRPDPFPMPTFAAWEAASELHSFHQSQQHYSTLHRVVDNGLQLSPEDDETTM VLVGTAHNM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CALHM5 |
Synonyms | CALHM5; C6orf188; FAM26E; Calcium homeostasis modulator protein 5; Protein FAM26E |
UniProt ID | Q8N5C1 |
◆ Recombinant Proteins | ||
AP1S3-1737M | Recombinant Mouse AP1S3 Protein | +Inquiry |
RAB4A-4555R | Recombinant Rat RAB4A Protein, His (Fc)-Avi-tagged | +Inquiry |
SDC1-5080H | Recombinant Human SDC1 Protein (Met1-Glu136), C-His tagged | +Inquiry |
DLK2-1044H | Recombinant Human DLK2 Protein (27-306 aa), GST-tagged | +Inquiry |
S-13M | Active Recombinant MERS-CoV Spike Protein (18-1296aa), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1765D | Active Native Datura Stramonium Lectin Protein, Agarose bound | +Inquiry |
Mb-8229M | Native Mouse Myoglobin | +Inquiry |
Complement C1r-45H | Native Human Complement C1r | +Inquiry |
Crp-5382R | Native Rat C-Reactive Protein, Petaxin Related | +Inquiry |
eCG-01E | Active Native Equine Gonadotropin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SkeletalMuscles-496C | Chicken Skeletal Muscles Lysate, Total Protein | +Inquiry |
ZNF669-31HCL | Recombinant Human ZNF669 293 Cell Lysate | +Inquiry |
GAPT-6022HCL | Recombinant Human GAPT 293 Cell Lysate | +Inquiry |
Peripheral-17H | Human Peripheral blood leukocyte lysate | +Inquiry |
TMEM220-964HCL | Recombinant Human TMEM220 293 Cell Lysate | +Inquiry |
See All Skeletal Muscles Total Protein Cell & Tissue Lysates |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CALHM5 Products
Required fields are marked with *
My Review for All CALHM5 Products
Required fields are marked with *
0
Inquiry Basket