Recombinant Full Length Human Probable G-Protein Coupled Receptor 123(Gpr123) Protein, His-Tagged
Cat.No. : | RFL4154HF |
Product Overview : | Recombinant Full Length Human Probable G-protein coupled receptor 123(GPR123) Protein (Q86SQ6) (1-560aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-560) |
Form : | Lyophilized powder |
AA Sequence : | MDLKTVLSLPRYPGEFLHPVVYACTAVMLLCLLASFVTYIVHQSAIRISRKGRHTLLNFC FHAALTFTVFAGGINRTKYPILCQAVGIVLHYSTLSTMLWIGVTARNIYKQVTKKAPLCL DTDQPPYPRQPLLRFYLVSGGVPFIICGVTAATNIRNYGTEDEDTAYCWMAWEPSLGAFY GPAAIITLVTCVYFLGTYVQLRRHPGRRYELRTQPEEQRRLATPEGGRGIRPGTPPAHDA PGASVLQNEHSFQAQLRAAAFTLFLFTATWAFGALAVSQGHFLDMVFSCLYGAFCVTLGL FVLIHHCAKREDVWQCWWACCPPRKDAHPALDANGAALGRAACLHSPGLGQPRGFAHPPG PCKMTNLQAAQGHASCLSPATPCCAKMHCEPLTADEAHVHLQEEGAFGHDPHLHGCLQGR TKPPYFSRHPAEEPEYAYHIPSSLDGSPRSSRTDSPPSSLDGPAGTHTLACCTQGDPFPM VTQPEGSDGSPALYSCPTQPGREAALGPGHLEMLRRTQSLPFGGPSQNGLPKGKLLEGLP FGTDGTGNIRTGPWKNETTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ADGRA1 |
Synonyms | ADGRA1; GPR123; KIAA1828; Adhesion G protein-coupled receptor A1; G-protein coupled receptor 123 |
UniProt ID | Q86SQ6 |
◆ Recombinant Proteins | ||
OLR1-1885H | Recombinant Human OLR1 protein, His & T7-tagged | +Inquiry |
ASMTL-12672Z | Recombinant Zebrafish ASMTL | +Inquiry |
HIST1H2AC-1517H | Recombinant Human HIST1H2AC protein, His & GST-tagged | +Inquiry |
RFL33698PF | Recombinant Full Length Pelodictyon Phaeoclathratiforme Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged | +Inquiry |
VAPB-1075H | Active Recombinant Human VAPB Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1778G | Active Native Galanthus Nivalis Lectin Protein, Fluorescein labeled | +Inquiry |
Fgg -69R | Native Rat Fibrinogen | +Inquiry |
Angiostatin-28H | Active Native Human Angiostatin K1-4 | +Inquiry |
GG-185R | Native Rabbit Gamma Globulin protein | +Inquiry |
CAT-15A | Active Native Aspergillus Niger Catalase | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPS2-7359HCL | Recombinant Human COPS2 293 Cell Lysate | +Inquiry |
IL4I1-5225HCL | Recombinant Human IL4I1 293 Cell Lysate | +Inquiry |
MTFR1-1144HCL | Recombinant Human MTFR1 cell lysate | +Inquiry |
HOMEZ-807HCL | Recombinant Human HOMEZ cell lysate | +Inquiry |
HAGHL-5643HCL | Recombinant Human HAGHL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ADGRA1 Products
Required fields are marked with *
My Review for All ADGRA1 Products
Required fields are marked with *
0
Inquiry Basket