Recombinant Full Length Human PRKAR1A Protein, C-Flag-tagged
Cat.No. : | PRKAR1A-1070HFL |
Product Overview : | Recombinant Full Length Human PRKAR1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. This gene encodes one of the regulatory subunits. This protein was found to be a tissue-specific extinguisher that down-regulates the expression of seven liver genes in hepatoma x fibroblast hybrids. Mutations in this gene cause Carney complex (CNC). This gene can fuse to the RET protooncogene by gene rearrangement and form the thyroid tumor-specific chimeric oncogene known as PTC2. A nonconventional nuclear localization sequence (NLS) has been found for this protein which suggests a role in DNA replication via the protein serving as a nuclear transport protein for the second subunit of the Replication Factor C (RFC40). Several alternatively spliced transcript variants encoding two different isoforms have been observed. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 42.8 kDa |
AA Sequence : | MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEEAKQIQNLQK AGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSH LDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQGETDVYVNNEWATSVGEGGSFGELALIYGTP RAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQ KIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKL DRPRFERVLGPCSDILKRNIQQYNSFVSLSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Protein Pathways : | Apoptosis, Insulin signaling pathway |
Full Length : | Full L. |
Gene Name | PRKAR1A protein kinase cAMP-dependent type I regulatory subunit alpha [ Homo sapiens (human) ] |
Official Symbol | PRKAR1A |
Synonyms | CAR; CNC; CNC1; PKR1; TSE1; ADOHR; PPNAD1; PRKAR1; ACRDYS1 |
Gene ID | 5573 |
mRNA Refseq | NM_002734.5 |
Protein Refseq | NP_002725.1 |
MIM | 188830 |
UniProt ID | P10644 |
◆ Recombinant Proteins | ||
RFL24573GF | Recombinant Full Length Geobacillus Sp. Upf0295 Protein Gwch70_0499 (Gwch70_0499) Protein, His-Tagged | +Inquiry |
PPAN-11509Z | Recombinant Zebrafish PPAN | +Inquiry |
CCNG1-9922Z | Recombinant Zebrafish CCNG1 | +Inquiry |
ITGAIIb&ITGB3-0198H | Active Recombinant Human ITGAIIb&ITGB3 protein, His-tagged | +Inquiry |
Ensa-2834M | Recombinant Mouse Ensa Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
HPX-207H | Native Human Hemopexin | +Inquiry |
TF-132B | Native Bovine Transferrin | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
Laminin-33H | Native Human Laminin protein | +Inquiry |
LYZ-249H | Active Native Human Lysozyme | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX2-1594HCL | Recombinant Human SNX2 293 Cell Lysate | +Inquiry |
FBLN5-6317HCL | Recombinant Human FBLN5 293 Cell Lysate | +Inquiry |
LRRC23-4641HCL | Recombinant Human LRRC23 293 Cell Lysate | +Inquiry |
Spleen-467H | Human Spleen Lupus Lysate | +Inquiry |
APOL4-99HCL | Recombinant Human APOL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRKAR1A Products
Required fields are marked with *
My Review for All PRKAR1A Products
Required fields are marked with *
0
Inquiry Basket