Recombinant Full Length Human PPP1R1A Protein, C-Flag-tagged

Cat.No. : PPP1R1A-697HFL
Product Overview : Recombinant Full Length Human PPP1R1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Predicted to enable protein serine/threonine phosphatase inhibitor activity. Predicted to be involved in intracellular signal transduction. Predicted to be active in cytoplasm.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 18.8 kDa
AA Sequence : MEQDNSPQKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPHLKSTLAMSPRQ RKKMTRITPTMKELQMMVEHHLGQQQQGEEPEGAAESTGTQESRPPGIPDTEVESRLGTSGTAKKTAECI
PKTHERGSKEPSTKEPSTHIPPLDSKGANSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Protein Pathways : Long-term potentiation
Full Length : Full L.
Gene Name PPP1R1A protein phosphatase 1 regulatory inhibitor subunit 1A [ Homo sapiens (human) ]
Official Symbol PPP1R1A
Synonyms I1; IPP1
Gene ID 5502
mRNA Refseq NM_006741.4
Protein Refseq NP_006732.3
MIM 613246
UniProt ID Q13522

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PPP1R1A Products

Required fields are marked with *

My Review for All PPP1R1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon