Recombinant Full Length Human PPBP, GST-tagged

• Cat.No.: PPBP-206H
• Product Overview: Recombinant Human PPBP(1 a.a. - 128 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-128 a.a.
• Description: This gene encodes a member of the subtilisin-like proprotein convertase family. These enzymes process latent precursor proteins into their biologically active products. The encoded protein plays a critical role in reproduction and processes multiple prohormones including pro-pituitary adenylate cyclase-activating protein (proPACAP) and pro-insulin-like growth factor II.
• Molecular Mass: 40.3 kDa
• AA Sequence: MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPK NIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PPBP pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) [ Homo sapiens (human) ]
• Official Symbol: PPBP
• Synonyms: PPBP; PBP; TC1; TC2; TGB; LDGF; MDGF; TGB1; B-TG1; CTAP3; CXCL7; NAP-2; SCYB7; THBGB; LA-PF4; THBGB1; Beta-TG; CTAPIII; CTAP-III; pro-platelet basic protein (chemokine (C-X-C motif) ligand 7); platelet basic protein; thrombocidin 1; thrombocidin 2; beta-thromboglobulin; CXC chemokine ligand 7; C-X-C motif chemokine 7; thromboglobulin, beta-1; small inducible cytokine B7; small-inducible cytokine B7; leukocyte-derived growth factor; low-affinity platelet factor IV; neutrophil-activating peptide 2; neutrophil-activating peptide-2; macrophage-derived growth factor; connective tissue-activating peptide III; small inducible cytokine subfamily B, member 7
• Gene ID: 5473
• mRNA Refseq: NM_002704
• Protein Refseq: NP_002695
• MIM: 121010
• UniProt ID: P02775
• Chromosome Location: 4q12-q13
• Pathway: Chemokine receptors bind chemokines; Chemokine signaling pathway; Cytokine-cytokine receptor interaction
• Function: chemokine activity; glucose transmembrane transporter activity; growth factor activity