Recombinant Full Length Human POU2F3 Protein, C-Flag-tagged
Cat.No. : | POU2F3-981HFL |
Product Overview : | Recombinant Full Length Human POU2F3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways. The encoded protein is primarily expressed in the epidermis, and plays a critical role in keratinocyte proliferation and differentiation. The encoded protein is also a candidate tumor suppressor protein, and aberrant promoter methylation of this gene may play a role in cervical cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 47.3 kDa |
AA Sequence : | MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPA MMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQPGQQGLQPNLLPFPQQQSGLLLPQ TGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSGGADEPSDLEELEKFAKTFKQRRIKLGFTQG DVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPSDPSVSTPSSYPSLSEVFGR KRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPIKPP VYNSRLVSPSGSLGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSF NSSGSWYRWNHSTYLHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | POU2F3 POU class 2 homeobox 3 [ Homo sapiens (human) ] |
Official Symbol | POU2F3 |
Synonyms | PLA1; OCT11; PLA-1; Epoc-1; OCT-11; OTF-11; Skn-1a |
Gene ID | 25833 |
mRNA Refseq | NM_014352.4 |
Protein Refseq | NP_055167.2 |
MIM | 607394 |
UniProt ID | Q9UKI9 |
◆ Recombinant Proteins | ||
POU2F3-7864Z | Recombinant Zebrafish POU2F3 | +Inquiry |
POU2F3-1738H | Recombinant Human POU2F3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pou2f3-5019M | Recombinant Mouse Pou2f3 Protein, Myc/DDK-tagged | +Inquiry |
POU2F3-4258Z | Recombinant Zebrafish POU2F3 | +Inquiry |
POU2F3-6682H | Recombinant Human POU2F3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
POU2F3-3002HCL | Recombinant Human POU2F3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All POU2F3 Products
Required fields are marked with *
My Review for All POU2F3 Products
Required fields are marked with *
0
Inquiry Basket