Recombinant Full Length Human PM20D1 Protein, C-Flag-tagged
Cat.No. : | PM20D1-1790HFL |
Product Overview : | Recombinant Full Length Human PM20D1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides. Involved in several processes, including amide biosynthetic process; cellular amide catabolic process; and negative regulation of neuron death. Located in extracellular exosome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.6 kDa |
AA Sequence : | MAQRCVCVLALVAMLLLVFPTVSRSMGPRSGEHQRASRIPSQFSKEERVAMKEALKGAIQIPTVTFSSEK SNTTALAEFGKYIHKVFPTVVSTSFIQHEVVEEYSHLFTIQGSDPSLQPYLLMAHFDVVPAPEEGWEVPP FSGLERDGVIYGWGTLDDKNSVMALLQALELLLIRKYIPRRSFFISLGHDEESSGTGAQRISALLQSRGV QLAFIVDEGGFILDDFIPNFKKPIALIAVSEKGSMNLMLQVNMTSGHSSAPPKETSIGILAAAVSRLEQT PMPIIFGSGTVVTVLQQLANEFPFPVNIILSNPWLFEPLISRFMERNPLTNAIIRTTTALTIFKAGVKFN VIPPVAQATVNFRIHPGQTVQEVLELTKNIVADNRVQFHVLSAFDPLPVSPSDDKALGYQLLRQTVQSVF PEVNITAPVTSIGNTDSRFFTNLTTGIYRFYPIYIQPEDFKRIHGVNEKISVQAYETQVKFIFELIQNAD TDQEPVSHLHKL SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | PM20D1 peptidase M20 domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | PM20D1 |
Synonyms | Cps1 |
Gene ID | 148811 |
mRNA Refseq | NM_152491.5 |
Protein Refseq | NP_689704.4 |
MIM | 617124 |
UniProt ID | Q6GTS8 |
◆ Recombinant Proteins | ||
Pm20d1-4950M | Recombinant Mouse Pm20d1 Protein, Myc/DDK-tagged | +Inquiry |
PM20D1-1715H | Recombinant Human PM20D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PM20D1-6869M | Recombinant Mouse PM20D1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PM20D1-2151H | Recombinant Human PM20D1 Protein, MYC/DDK-tagged | +Inquiry |
PM20D1-13005M | Recombinant Mouse PM20D1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PM20D1-642HCL | Recombinant Human PM20D1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PM20D1 Products
Required fields are marked with *
My Review for All PM20D1 Products
Required fields are marked with *
0
Inquiry Basket