Recombinant Full Length Human PLBD2 Protein, C-Flag-tagged
Cat.No. : | PLBD2-18HFL |
Product Overview : | Recombinant Full Length Human PLBD2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable phospholipase activity. Predicted to be involved in phospholipid catabolic process. Located in extracellular exosome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 61.3 kDa |
AA Sequence : | MVGQMYCYPGSHLARALTRALALALVLALLVGPFLSGLAGAIPAPGGRWARDGQVPPASRSRSVLLDVSA GQLLMVDGRHPDAVAWANLTNAIRETGWAFLELGTSGQYNDSLQAYAAGVVEAAVSEELIYMHWMNTVVN YCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWHQVRLTLLQLKGLEDSYEGRVSFPAGKFTIK PLGFLLLQLSGDLEDLELALNKTKIKPSLGSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQ FREGPWGDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGCVLEWVRNI VANRLASDGATWADIFKRFNSGTYNNQWMIVDYKAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQK TYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLS LCKACNPQPNGENAISARSDLNPANGSYPFKALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPF QWSTSPFSGLLHMGQPDLWKFAPVKVSWDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | PLBD2 phospholipase B domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | PLBD2 |
Synonyms | P76 |
Gene ID | 196463 |
mRNA Refseq | NM_173542.4 |
Protein Refseq | NP_775813.2 |
MIM | 620097 |
UniProt ID | Q8NHP8 |
◆ Recombinant Proteins | ||
Plbd2-1328R | Recombinant Rat Plbd2 Protein, His-SUMO-tagged | +Inquiry |
PLBD2-3371C | Recombinant Chinese hamster PLBD2 protein(Leu38-Asp585), His-tagged | +Inquiry |
Plbd2-016H | Recombinant Hamster phospholipase B domain containing 2 Protein, His tagged | +Inquiry |
PLBD2-2112H | Recombinant Human PLBD2 Protein, MYC/DDK-tagged | +Inquiry |
PLBD2-2164M | Recombinant Mouse PLBD2 Protein (47-594 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLBD2-922HCL | Recombinant Human PLBD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLBD2 Products
Required fields are marked with *
My Review for All PLBD2 Products
Required fields are marked with *
0
Inquiry Basket