Recombinant Full Length Human PHYHIPL Protein, C-Flag-tagged
Cat.No. : | PHYHIPL-2139HFL |
Product Overview : | Recombinant Full Length Human PHYHIPL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Located in cytoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 42.3 kDa |
AA Sequence : | MEVPRLDHALNSPTSPCEEVIKNLSLEAIQLCDRDGNKSQDSGIAEMEELPVPHNIKISNITCDSFKISW EMDSKSKDRITHYFIDLNKKENKNSNKFKHKDVPTKLVAKAVPLPMTVRGHWFLSPRTEYTVAVQTASKQ VDGDYVVSEWSEIIEFCTADYSKVHLTQLLEKAEVIAGRMLKFSVFYRNQHKEYFDYVREHHGNAMQPSV KDNSGSHGSPISGKLEGIFFSCSTEFNTGKPPQDSPYGRYRFEIAAEKLFNPNTNLYFGDFYCMYTAYHY VILVIAPVGSPGDEFCKQRLPQLNSKDNKFLTCTEEDGVLVYHHAQDVILEVIYTDPVDLSLGTVAEITG HQLMSLSTANAKKDPSCKTCNISVGR myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | PHYHIPL phytanoyl-CoA 2-hydroxylase interacting protein like [ Homo sapiens (human) ] |
Official Symbol | PHYHIPL |
Synonyms | KIAA1796 |
Gene ID | 84457 |
mRNA Refseq | NM_032439.4 |
Protein Refseq | NP_115815.2 |
UniProt ID | Q96FC7 |
◆ Recombinant Proteins | ||
CBX8-371H | Recombinant Human CBX8 protein, His&Myc-tagged | +Inquiry |
Ttyh2-597M | Recombinant Mouse Ttyh2 Protein, MYC/DDK-tagged | +Inquiry |
RFL1070HF | Recombinant Full Length Human Inward Rectifier Potassium Channel 2(Kcnj2) Protein, His-Tagged | +Inquiry |
EXOSC10-12594H | Recombinant Human EXOSC10, GST-tagged | +Inquiry |
NS5B-5086H | Recombinant Hepatitis C virus genotype 1a NS5B protein, His-Myc-tagged | +Inquiry |
◆ Native Proteins | ||
C1q-07R | Native Rat C1q Protein | +Inquiry |
MFGE8-288B | Native Bovine Lactadherin | +Inquiry |
MV-01 | Native Measles Virus Antigen (Premium) | +Inquiry |
CA 72-4-379H | Active Native Human Cancer Antigen 72-4 | +Inquiry |
Fxa-282B | Active Native Bovine Factor Xa - EGR | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSNK1E-7240HCL | Recombinant Human CSNK1E 293 Cell Lysate | +Inquiry |
ERI3-501HCL | Recombinant Human ERI3 lysate | +Inquiry |
AMHR2-8883HCL | Recombinant Human AMHR2 293 Cell Lysate | +Inquiry |
PPP2R3C-2920HCL | Recombinant Human PPP2R3C 293 Cell Lysate | +Inquiry |
TRAF6-818HCL | Recombinant Human TRAF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PHYHIPL Products
Required fields are marked with *
My Review for All PHYHIPL Products
Required fields are marked with *
0
Inquiry Basket