Recombinant Full Length Human PDX1 Protein, C-Flag-tagged
Cat.No. : | PDX1-1923HFL |
Product Overview : | Recombinant Full Length Human PDX1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (IDDM), as well as maturity onset diabetes of the young type 4 (MODY4). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 30.6 kDa |
AA Sequence : | MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEV PPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYA AEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRG GGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQ EPR SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors |
Protein Pathways : | Maturity onset diabetes of the young, Type II diabetes mellitus |
Full Length : | Full L. |
Gene Name | PDX1 pancreatic and duodenal homeobox 1 [ Homo sapiens (human) ] |
Official Symbol | PDX1 |
Synonyms | GSF; IPF1; IUF1; IDX-1; MODY4; PDX-1; STF-1; PAGEN1 |
Gene ID | 3651 |
mRNA Refseq | NM_000209.4 |
Protein Refseq | NP_000200.1 |
MIM | 600733 |
UniProt ID | P52945 |
◆ Recombinant Proteins | ||
PDX1-6619M | Recombinant Mouse PDX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PDX1-9011Z | Recombinant Zebrafish PDX1 | +Inquiry |
Pdx1-4780M | Recombinant Mouse Pdx1 Protein, Myc/DDK-tagged | +Inquiry |
Pdx1-2749R | Recombinant Rat Pdx1 Protein, His&GST-tagged | +Inquiry |
PDX1-367HF | Recombinant Full Length Human PDX1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDX1-3318HCL | Recombinant Human PDX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDX1 Products
Required fields are marked with *
My Review for All PDX1 Products
Required fields are marked with *
0
Inquiry Basket