Recombinant Full Length Human PDHA2 Protein, C-Flag-tagged
Cat.No. : | PDHA2-1724HFL |
Product Overview : | Recombinant Full Length Human PDHA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables pyruvate dehydrogenase (acetyl-transferring) activity. Involved in pyruvate metabolic process. Located in mitochondrion and nucleolus. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 42.8 kDa |
AA Sequence : | MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVR RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTGRR GGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAA LWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILM ELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQF ATTDPEPHLEELGHHIYSSDSSFEVRGANPWIKFKSVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Butanoate metabolism, Citrate cycle (TCA cycle), Glycolysis / Gluconeogenesis, Metabolic pathways, Pyruvate metabolism, Valine, leucine and isoleucine biosynthesis |
Full Length : | Full L. |
Gene Name | PDHA2 pyruvate dehydrogenase E1 subunit alpha 2 [ Homo sapiens (human) ] |
Official Symbol | PDHA2 |
Synonyms | PDHAL; SPGF70 |
Gene ID | 5161 |
mRNA Refseq | NM_005390.5 |
Protein Refseq | NP_005381.1 |
MIM | 179061 |
UniProt ID | P29803 |
◆ Recombinant Proteins | ||
PDHA2-4002R | Recombinant Rat PDHA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PDHA2-6599M | Recombinant Mouse PDHA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PDHA2-12573M | Recombinant Mouse PDHA2 Protein | +Inquiry |
PDHA2-2574H | Recombinant Human PDHA2 Protein, His-tagged | +Inquiry |
PDHA2-1636H | Recombinant Human PDHA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDHA2-3333HCL | Recombinant Human PDHA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDHA2 Products
Required fields are marked with *
My Review for All PDHA2 Products
Required fields are marked with *
0
Inquiry Basket