Recombinant Full Length Human PDE1B Protein, C-Flag-tagged
Cat.No. : | PDE1B-704HFL |
Product Overview : | Recombinant Full Length Human PDE1B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE1 subfamily. Members of the PDE1 family are calmodulin-dependent PDEs that are stimulated by a calcium-calmodulin complex. This PDE has dual-specificity for the second messengers, cAMP and cGMP, with a preference for cGMP as a substrate. cAMP and cGMP function as key regulators of many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 61.2 kDa |
AA Sequence : | MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNLEYTASLLEAV YIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKPKFRSIVHAVQAGIFVERMFR RTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNQAADDHALRTIVFELLTRHNLISRFKIPTVFLMSFLDA LETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKS ECAIVYNDRSVLENHHISSVFRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTAL QQLERIDKPKALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS QIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQ ENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Calcium signaling pathway, Progesterone-mediated oocyte maturation, Purine metabolism |
Full Length : | Full L. |
Gene Name | PDE1B phosphodiesterase 1B [ Homo sapiens (human) ] |
Official Symbol | PDE1B |
Synonyms | PDE1B1; PDES1B; HEL-S-79p |
Gene ID | 5153 |
mRNA Refseq | NM_000924.4 |
Protein Refseq | NP_000915.1 |
MIM | 171891 |
UniProt ID | Q01064 |
◆ Recombinant Proteins | ||
PDE1B-3164R | Recombinant Rhesus Macaque PDE1B Protein, His (Fc)-Avi-tagged | +Inquiry |
PDE1B-745H | Recombinant Human PDE1B Protein, MYC/DDK-tagged | +Inquiry |
Pde1b-4743M | Recombinant Mouse Pde1b Protein, Myc/DDK-tagged | +Inquiry |
PDE1B-3346R | Recombinant Rhesus monkey PDE1B Protein, His-tagged | +Inquiry |
PDE1B-1631H | Recombinant Human PDE1B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDE1B-627HCL | Recombinant Human PDE1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDE1B Products
Required fields are marked with *
My Review for All PDE1B Products
Required fields are marked with *
0
Inquiry Basket